Reaction Details |
| Report a problem with these data |
Target | N-formyl peptide receptor 2 |
---|
Ligand | BDBM37719 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose Response Assay for Formylpeptide Receptor-Like-1 (FPRL1) Ligands and Dose Response Counter-Screen Assay for Formylpeptide Receptor (FPR) Ligands |
---|
IC50 | 18500±n/a nM |
---|
Comments | Extracted from aid = 520 and tid = 3 |
---|
Citation | PubChem, PC Dose Response Assay for Formylpeptide Receptor-Like-1 (FPRL1) Ligands and Dose Response Counter-Screen Assay for Formylpeptide Receptor (FPR) Ligands PubChem Bioassay(2007)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
N-formyl peptide receptor 2 |
---|
Name: | N-formyl peptide receptor 2 |
Synonyms: | ALXR, FPRL1, FPR2 | FMLP-related receptor I FMLP-R-I | FPR2 | FPR2_HUMAN | FPRH1 | FPRL1 | Formyl Peptide Receptor-Like 1 | HM63 | LXA4 receptor | LXA4R | Lipoxin A4 receptor | Lipoxin A4 receptor (LXA4) | RFP | hFPRL |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 38968.35 |
Organism: | Homo sapiens (Human) |
Description: | P25090 |
Residue: | 351 |
Sequence: | METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVT
TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIA
LDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNF
ASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPM
LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
|
|
|
BDBM37719 |
---|
n/a |
---|
Name | BDBM37719 |
Synonyms: | 2-[[4-methyl-5-[[(3,4,5-triethoxybenzoyl)amino]methyl]-1,2,4-triazol-3-yl]thio]acetic acid methyl ester | 2-[[4-methyl-5-[[[oxo-(3,4,5-triethoxyphenyl)methyl]amino]methyl]-1,2,4-triazol-3-yl]thio]acetic acid methyl ester | MLS000087567 | SMR000023789 | cid_3240462 | methyl 2-[[4-methyl-5-[[(3,4,5-triethoxybenzoyl)amino]methyl]-1,2,4-triazol-3-yl]sulfanyl]acetate | methyl 2-[[4-methyl-5-[[(3,4,5-triethoxyphenyl)carbonylamino]methyl]-1,2,4-triazol-3-yl]sulfanyl]ethanoate | methyl [(4-methyl-5-{[(3,4,5-triethoxybenzoyl)amino]methyl}-4H-1,2,4-triazol-3-yl)thio]acetate |
Type | Small organic molecule |
Emp. Form. | C20H28N4O6S |
Mol. Mass. | 452.525 |
SMILES | CCOc1cc(cc(OCC)c1OCC)C(=O)NCc1nnc(SCC(=O)OC)n1C |
Structure |
|