new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNuclear receptor ROR-alpha
LigandBDBM38939
Substrate/Competitorn/a
Meas. Tech.Counterscreen for inhibitors of the nuclear receptor Steroidogenic Factor 1 (SF-1): A cell-based dose-response assay for inhibition of the RAR-related orphan receptor A (RORA)
IC50 7315±n/a nM
Citation PubChem PC Counterscreen for inhibitors of the nuclear receptor Steroidogenic Factor 1 (SF-1): A cell-based dose-response assay for inhibition of the RAR-related orphan receptor A (RORA) PubChem Bioassay (2007)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Nuclear receptor ROR-alpha
Name:Nuclear receptor ROR-alpha
Synonyms:Nuclear receptor ROR-alpha (Retinoid-related orphan receptor-alpha) (Nuclear receptor RZR-alpha).
Type:PROTEIN
Mol. Mass.:63033.59
Organism:Homo sapiens (Human)
Description:EBI_101591
Residue:556
Sequence:
MNEGAPGDSDLETEARVPWSIMGHCLRTGQARMSATPTPAGEGARRDELFGILQILHQCI
LSSGDAFVLTGVCCSWRQNGKPPYSQKEDKEVQTGYMNAQIEIIPCKICGDKSSGIHYGV
ITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGR
MSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGH
TPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPT
VSMAELEHLAQNISKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKI
TEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYAS
PDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEIALFSAFVLMSADRSWLQEKVKIEKLQQ
KIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLY
KELFTSEFEPAMQIDG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM38939
n/a
NameBDBM38939
Synonyms:(4E)-3-hydroxy-4-[[(4-methyl-2-methylimino-1,3-thiazol-3-yl)amino]methylidene]cyclohexa-2,5-dien-1-one | (4E)-3-hydroxy-4-[[(4-methyl-2-methylimino-3-thiazolyl)amino]methylidene]-1-cyclohexa-2,5-dienone | (4E)-3-hydroxy-4-[[(4-methyl-2-methylimino-4-thiazolin-3-yl)amino]methylene]cyclohexa-2,5-dien-1-one | (4E)-4-[[(4-methyl-2-methylimino-1,3-thiazol-3-yl)amino]methylidene]-3-oxidanyl-cyclohexa-2,5-dien-1-one | MLS000096544 | SMR000062389 | cid_5742517
TypeSmall organic molecule
Emp. Form.C12H13N3O2S
Mol. Mass.263.316
SMILESCN=c1scc(C)n1N=Cc1ccc(O)cc1O |w:8.8,1.0|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: