| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-related protein A1 |
|---|
| Ligand | BDBM34163 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | TR-FRET secondary assay for HTS discovery of chemical inhibitors of anti-apoptotic protein Bfl-1 |
|---|
| IC50 | >100000±0 nM |
|---|
| Citation |  PubChem, PC TR-FRET secondary assay for HTS discovery of chemical inhibitors of anti-apoptotic protein Bfl-1 PubChem Bioassay(2008)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Bcl-2-related protein A1 |
|---|
| Name: | Bcl-2-related protein A1 |
|---|
| Synonyms: | A1 | A1-A | B-cell leukemia/lymphoma 2 related protein A1a | B2LA1_MOUSE | Bcl2a1 | Bcl2a1a | Bfl-1 | Bfl1 | Hemopoietic-specific early response protein | Protein BFL-1 |
|---|
| Type: | Apoptosis regulator protein |
|---|
| Mol. Mass.: | 19909.74 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | gi_11024684 |
|---|
| Residue: | 172 |
|---|
| Sequence: | MAESELMHIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFH
VESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVCAYKQVSS
FVAEFIMNNTGEWIRQNGGWEDGFIKKFEPKSGWLTFLQMTGQIWEMLFLLK
|
|
|
|---|
| BDBM34163 |
|---|
| n/a |
|---|
| Name | BDBM34163 |
|---|
| Synonyms: | 3-Amino-7-benzyl-1-thioxo-5,6,7,8-tetrahydro-1H-thiopyrano[3,4-c]pyridine-4-carbonitrile | 3-amino-7-(phenylmethyl)-1-sulfanylidene-6,8-dihydro-5H-thiopyrano[3,4-c]pyridine-4-carbonitrile | 3-amino-7-benzyl-1-sulfanylidene-6,8-dihydro-5H-thiopyrano[3,4-c]pyridine-4-carbonitrile | 3-amino-7-benzyl-1-thioxo-6,8-dihydro-5H-thiopyrano[3,4-c]pyridine-4-carbonitrile | 3-azanyl-7-(phenylmethyl)-1-sulfanylidene-6,8-dihydro-5H-thiopyrano[3,4-c]pyridine-4-carbonitrile | MLS000030905 | SMR000011772 | cid_787437 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H15N3S2 |
|---|
| Mol. Mass. | 313.44 |
|---|
| SMILES | Nc1sc(=S)c2CN(Cc3ccccc3)CCc2c1C#N |
|---|
| Structure | 
|
|---|
Search and Browse
