Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 2 |
---|
Ligand | BDBM34671 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose Response Cell Based Assay for Antagonists of the S1P2 Receptor |
---|
IC50 | 1402±n/a nM |
---|
Citation | PubChem, PC Dose Response Cell Based Assay for Antagonists of the S1P2 Receptor PubChem Bioassay(2007)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 2 |
---|
Name: | Sphingosine 1-phosphate receptor 2 |
Synonyms: | EDG5 | S1P2 | S1PR2 | S1PR2_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-5 | Sphingosine-1-phosphate receptor 2 | ndothelial differentiation G-protein coupled receptor 5 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 38883.16 |
Organism: | Homo sapiens (Human) |
Description: | Membranes isolated from S1P2-transfected CHO cells were used in ligand binding assay. |
Residue: | 353 |
Sequence: | MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR
NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV
FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS
TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG
VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL
RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
|
|
|
BDBM34671 |
---|
n/a |
---|
Name | BDBM34671 |
Synonyms: | 1,3,6-Trimethyl-1H-pyrimido[5,4-e][1,2,4]triazine-5,7-dione | 1,3,6-trimethylpyrimido[5,4-e][1,2,4]triazine-5,7-dione | 1,3,6-trimethylpyrimido[5,4-e][1,2,4]triazine-5,7-quinone | MLS000528498 | SMR000121073 | US9073941, 611 | cid_460747 |
Type | Small organic molecule |
Emp. Form. | C8H9N5O2 |
Mol. Mass. | 207.1894 |
SMILES | Cc1nn(C)c2nc(=O)n(C)c(=O)c2n1 |
Structure |
|