| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 2 |
|---|
| Ligand | BDBM41648 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose Response Cell Based Assay for Agonists of the S1P2 Receptor of Purchased Analogues |
|---|
| EC50 | 1202±n/a nM |
|---|
| Citation |  PubChem, PC Dose Response Cell Based Assay for Agonists of the S1P2 Receptor of Purchased Analogues PubChem Bioassay(2007)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 2 |
|---|
| Name: | Sphingosine 1-phosphate receptor 2 |
|---|
| Synonyms: | EDG5 | S1P2 | S1PR2 | S1PR2_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-5 | Sphingosine-1-phosphate receptor 2 | ndothelial differentiation G-protein coupled receptor 5 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 38883.16 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Membranes isolated from S1P2-transfected CHO cells were used in ligand binding assay. |
|---|
| Residue: | 353 |
|---|
| Sequence: | MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR
NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV
FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS
TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG
VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL
RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
|
|
|
|---|
| BDBM41648 |
|---|
| n/a |
|---|
| Name | BDBM41648 |
|---|
| Synonyms: | 1-[2-(1-benzyl-2,5-dimethyl-pyrrol-3-yl)-2-keto-ethyl]pyrrolidine-2,5-quinone | 1-[2-(1-benzyl-2,5-dimethylpyrrol-3-yl)-2-oxoethyl]pyrrolidine-2,5-dione | 1-[2-[2,5-dimethyl-1-(phenylmethyl)-3-pyrrolyl]-2-oxoethyl]pyrrolidine-2,5-dione | 1-[2-[2,5-dimethyl-1-(phenylmethyl)pyrrol-3-yl]-2-oxidanylidene-ethyl]pyrrolidine-2,5-dione | MLS000057725 | SMR000068650 | cid_2113511 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H20N2O3 |
|---|
| Mol. Mass. | 324.3737 |
|---|
| SMILES | Cc1cc(C(=O)CN2C(=O)CCC2=O)c(C)n1Cc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
