| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-related protein A1 |
|---|
| Ligand | BDBM39118 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | In Vitro Bfl-1 Dose Response Fluorescence Polarization Assay for SAR Study |
|---|
| IC50 | 6780±1900 nM |
|---|
| Citation |  PubChem, PC In Vitro Bfl-1 Dose Response Fluorescence Polarization Assay for SAR Study PubChem Bioassay(2008)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Bcl-2-related protein A1 |
|---|
| Name: | Bcl-2-related protein A1 |
|---|
| Synonyms: | A1 | A1-A | B-cell leukemia/lymphoma 2 related protein A1a | B2LA1_MOUSE | Bcl2a1 | Bcl2a1a | Bfl-1 | Bfl1 | Hemopoietic-specific early response protein | Protein BFL-1 |
|---|
| Type: | Apoptosis regulator protein |
|---|
| Mol. Mass.: | 19909.74 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | gi_11024684 |
|---|
| Residue: | 172 |
|---|
| Sequence: | MAESELMHIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFH
VESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVCAYKQVSS
FVAEFIMNNTGEWIRQNGGWEDGFIKKFEPKSGWLTFLQMTGQIWEMLFLLK
|
|
|
|---|
| BDBM39118 |
|---|
| n/a |
|---|
| Name | BDBM39118 |
|---|
| Synonyms: | 2-mesyl-4-(3-methoxyphenyl)-6-(trifluoromethyl)pyrimidine | 4-(3-methoxyphenyl)-2-methylsulfonyl-6-(trifluoromethyl)pyrimidine | MLS-0066988.0001 | US11725000, Compound 52 | cid_751044 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H11F3N2O3S |
|---|
| Mol. Mass. | 332.298 |
|---|
| SMILES | COc1cccc(c1)-c1cc(nc(n1)S(C)(=O)=O)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
