| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Galanin receptor type 2 |
|---|
| Ligand | BDBM42045 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose response counterscreen for antagonists of galanin receptor 2 (GalR2): a cell-based high-throughput screening assay for inhibitors of beta-lactamase activity |
|---|
| IC50 | 17070±n/a nM |
|---|
| Citation |  PubChem, PC Dose response counterscreen for antagonists of galanin receptor 2 (GalR2): a cell-based high-throughput screening assay for inhibitors of beta-lactamase activity PubChem Bioassay(2008)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Galanin receptor type 2 |
|---|
| Name: | Galanin receptor type 2 |
|---|
| Synonyms: | GALNR2 | GALR2 | GALR2_HUMAN | Galanin R2 | Galanin receptor 2 | Galanin receptor type 2 | Galanin receptor type 2 (GAL2-R) (GALR2). |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 41724.40 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Galanin R2 GALR2 HUMAN::O43603 |
|---|
| Residue: | 387 |
|---|
| Sequence: | MNVSGCPGAGNASQAGGGGGWHPEAVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTT
NLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVS
LDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWS
APRRRAMDICTFVFSYLLPVLVLGLTYARTLRYLWRAVDPVAAGSGARRAKRKVTRMILI
VAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR
KGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAGALRPCPGASQ
PCILEPCPGPSWQGPKAGDSILTVDVA
|
|
|
|---|
| BDBM42045 |
|---|
| n/a |
|---|
| Name | BDBM42045 |
|---|
| Synonyms: | MLS000554273 | S-[1-(1-acetylindol-3-yl)-2-nitroethyl] ethanethioate | S-[1-(1-ethanoylindol-3-yl)-2-nitro-ethyl] ethanethioate | SMR000146590 | Thioacetic acid S-[1-(1-acetyl-1H-indol-3-yl)-2-nitro-ethyl] ester | cid_3775080 | ethanethioic acid S-[1-(1-acetyl-3-indolyl)-2-nitroethyl] ester | ethanethioic acid S-[1-(1-acetylindol-3-yl)-2-nitro-ethyl] ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H14N2O4S |
|---|
| Mol. Mass. | 306.337 |
|---|
| SMILES | CC(=O)SC(C[N+]([O-])=O)c1cn(C(C)=O)c2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
