Reaction Details |
| Report a problem with these data |
Target | Galanin receptor type 2 |
---|
Ligand | BDBM42069 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose response counterscreen for antagonists of galanin receptor 2 (GalR2): a cell-based high-throughput screening assay for inhibitors of beta-lactamase activity |
---|
IC50 | 7528±n/a nM |
---|
Citation | PubChem, PC Dose response counterscreen for antagonists of galanin receptor 2 (GalR2): a cell-based high-throughput screening assay for inhibitors of beta-lactamase activity PubChem Bioassay(2008)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Galanin receptor type 2 |
---|
Name: | Galanin receptor type 2 |
Synonyms: | GALNR2 | GALR2 | GALR2_HUMAN | Galanin R2 | Galanin receptor 2 | Galanin receptor type 2 | Galanin receptor type 2 (GAL2-R) (GALR2). |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 41724.40 |
Organism: | Homo sapiens (Human) |
Description: | Galanin R2 GALR2 HUMAN::O43603 |
Residue: | 387 |
Sequence: | MNVSGCPGAGNASQAGGGGGWHPEAVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTT
NLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVS
LDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWS
APRRRAMDICTFVFSYLLPVLVLGLTYARTLRYLWRAVDPVAAGSGARRAKRKVTRMILI
VAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR
KGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAGALRPCPGASQ
PCILEPCPGPSWQGPKAGDSILTVDVA
|
|
|
BDBM42069 |
---|
n/a |
---|
Name | BDBM42069 |
Synonyms: | 2-acetamido-4,5-dinitro-benzoic acid ethyl ester | 2-acetamido-4,5-dinitrobenzoic acid ethyl ester | MLS000698400 | SMR000224624 | cid_4104905 | ethyl 2-(acetylamino)-4,5-dinitrobenzoate | ethyl 2-acetamido-4,5-dinitro-benzoate | ethyl 2-acetamido-4,5-dinitrobenzoate |
Type | Small organic molecule |
Emp. Form. | C11H11N3O7 |
Mol. Mass. | 297.2209 |
SMILES | CCOC(=O)c1cc(c(cc1NC(C)=O)[N+]([O-])=O)[N+]([O-])=O |
Structure |
|