| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Neuropeptide Y receptor type 2 |
|---|
| Ligand | BDBM42451 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose response counterscreen assay for neuropeptide Y receptor Y1 (NPY-Y1): Cell-based high throughput assay to measure NPY-Y2 antagonism |
|---|
| IC50 | >35000±n/a nM |
|---|
| Citation |  PubChem, PC Dose response counterscreen assay for neuropeptide Y receptor Y1 (NPY-Y1): Cell-based high throughput assay to measure NPY-Y2 antagonism PubChem Bioassay(2008)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Neuropeptide Y receptor type 2 |
|---|
| Name: | Neuropeptide Y receptor type 2 |
|---|
| Synonyms: | NPY-Y2 | NPY-Y2 receptor | NPY2-R | NPY2R | NPY2R_HUMAN | Neuropeptide Y receptor type 2 | Y2 receptor | neuropeptide Y receptor Y2 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 42734.65 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | NPY-Y2 NPY2R HUMAN::P49146 |
|---|
| Residue: | 381 |
|---|
| Sequence: | MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSI
ILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGP
VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLA
SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYT
RIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDL
KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAK
KNLEVRKNSGPNDSFTEATNV
|
|
|
|---|
| BDBM42451 |
|---|
| n/a |
|---|
| Name | BDBM42451 |
|---|
| Synonyms: | 5-hydroxy-1-methyl-4-(4-morpholinylmethyl)-2-[(phenylthio)methyl]-3-indolecarboxylic acid ethyl ester | 5-hydroxy-1-methyl-4-(morpholinomethyl)-2-[(phenylthio)methyl]indole-3-carboxylic acid ethyl ester | MLS000686738 | SMR000339830 | cid_1283502 | ethyl 1-methyl-4-(morpholin-4-ylmethyl)-5-oxidanyl-2-(phenylsulfanylmethyl)indole-3-carboxylate | ethyl 5-hydroxy-1-methyl-4-(morpholin-4-ylmethyl)-2-(phenylsulfanylmethyl)indole-3-carboxylate | ethyl 5-hydroxy-1-methyl-4-(morpholin-4-ylmethyl)-2-[(phenylthio)methyl]-1H-indole-3-carboxylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H28N2O4S |
|---|
| Mol. Mass. | 440.555 |
|---|
| SMILES | CCOC(=O)c1c(CSc2ccccc2)n(C)c2ccc(O)c(CN3CCOCC3)c12 |
|---|
| Structure | 
|
|---|
Search and Browse
