| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Apoptosis regulator Bcl-2 |
|---|
| Ligand | BDBM33200 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-2 |
|---|
| EC50 | 4950±n/a nM |
|---|
| Citation |  PubChem, PC Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-2 PubChem Bioassay(2008)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Apoptosis regulator Bcl-2 |
|---|
| Name: | Apoptosis regulator Bcl-2 |
|---|
| Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
|---|
| Type: | Homodimer or heterodimer |
|---|
| Mol. Mass.: | 26269.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P10415 |
|---|
| Residue: | 239 |
|---|
| Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
|---|
| BDBM33200 |
|---|
| n/a |
|---|
| Name | BDBM33200 |
|---|
| Synonyms: | 2-(2-furanyl)-4-quinolinecarboxylic acid [2-(diethylamino)-2-oxoethyl] ester | 2-(2-furyl)cinchoninic acid [2-(diethylamino)-2-keto-ethyl] ester | MLS000772521 | SMR000377201 | [2-(diethylamino)-2-oxidanylidene-ethyl] 2-(furan-2-yl)quinoline-4-carboxylate | [2-(diethylamino)-2-oxoethyl] 2-(furan-2-yl)quinoline-4-carboxylate | cid_2096417 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H20N2O4 |
|---|
| Mol. Mass. | 352.3838 |
|---|
| SMILES | CCN(CC)C(=O)COC(=O)c1cc(nc2ccccc12)-c1ccco1 |
|---|
| Structure | 
|
|---|
Search and Browse
