| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Induced myeloid leukemia cell differentiation protein Mcl-1 |
|---|
| Ligand | BDBM33066 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Multiplexed dose response screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Mcl-1. |
|---|
| EC50 | 3710±n/a nM |
|---|
| Citation |  PubChem, PC Multiplexed dose response screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Mcl-1. PubChem Bioassay(2008)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Induced myeloid leukemia cell differentiation protein Mcl-1 |
|---|
| Name: | Induced myeloid leukemia cell differentiation protein Mcl-1 |
|---|
| Synonyms: | BCL2L3 | Bcl-2-like protein 3 | Bcl-2-like protein 3 (Mcl-1) | Bcl-2-related protein EAT/mcl1 | Bcl2-L-3 | Induced myeloid leukemia cell differentiation protein (Mcl-1) | MCL1 | MCL1_HUMAN | Mcl-1 | Myeloid Cell factor-1 (Mcl-1) | Myeloid cell leukemia sequence 1 (BCL2-related) | mcl1/EAT |
|---|
| Type: | Membrane; Single-pass membrane protein |
|---|
| Mol. Mass.: | 37332.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q07820 |
|---|
| Residue: | 350 |
|---|
| Sequence: | MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
|
|
|
|---|
| BDBM33066 |
|---|
| n/a |
|---|
| Name | BDBM33066 |
|---|
| Synonyms: | 2,5-bis(chloranyl)-3-[2-(dimethylamino)-1,3-thiazol-5-yl]-6-pyrrolidin-1-yl-cyclohexa-2,5-diene-1,4-dione | 2,5-dichloro-3-[2-(dimethylamino)-1,3-thiazol-5-yl]-6-(1-pyrrolidinyl)benzo-1,4-quinone | 2,5-dichloro-3-[2-(dimethylamino)-1,3-thiazol-5-yl]-6-pyrrolidin-1-ylcyclohexa-2,5-diene-1,4-dione | 2,5-dichloro-3-[2-(dimethylamino)-5-thiazolyl]-6-(1-pyrrolidinyl)cyclohexa-2,5-diene-1,4-dione | 2,5-dichloro-3-[2-(dimethylamino)thiazol-5-yl]-6-pyrrolidino-p-benzoquinone | MLS000548208 | SMR000115102 | cid_1002248 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H15Cl2N3O2S |
|---|
| Mol. Mass. | 372.27 |
|---|
| SMILES | CN(C)c1ncc(s1)C1=C(Cl)C(=O)C(N2CCCC2)=C(Cl)C1=O |c:9,t:20| |
|---|
| Structure | 
|
|---|
Search and Browse
