| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 7 |
|---|
| Ligand | BDBM32347 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | CDK7 counterscreen of confirmed PKD inhibitors-57K library addition |
|---|
| IC50 | >100000±n/a nM |
|---|
| Citation |  PubChem, PC CDK7 counterscreen of confirmed PKD inhibitors-57K library addition PubChem Bioassay(2008)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Cyclin-dependent kinase 7 |
|---|
| Name: | Cyclin-dependent kinase 7 |
|---|
| Synonyms: | 39 kDa protein kinase | CAK | CAK1 | CDK-activating kinase | CDK-activating kinase 1 (CAK) | CDK7 | CDK7_HUMAN | CDKN7 | Cell division protein kinase 7 | Cyclin-Dependent Kinase 7 (CDK7) | Cyclin-dependent kinase 7 (CDK7/cyclin H) | MO15 | P39 Mo15 | STK1 | TFIIH basal transcription factor complex kinase subunit |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 39047.01 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 346 |
|---|
| Sequence: | MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTAL
REIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLM
TLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRA
PELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDM
CSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPG
PTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
|
|
|
|---|
| BDBM32347 |
|---|
| n/a |
|---|
| Name | BDBM32347 |
|---|
| Synonyms: | MLS000674332 | N-(4-fluorobenzyl)-2-(methylthio)benzamide | N-[(4-fluorophenyl)methyl]-2-(methylthio)benzamide | N-[(4-fluorophenyl)methyl]-2-methylsulfanyl-benzamide | N-[(4-fluorophenyl)methyl]-2-methylsulfanylbenzamide | SMR000297279 | cid_2592173 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H14FNOS |
|---|
| Mol. Mass. | 275.341 |
|---|
| SMILES | CSc1ccccc1C(=O)NCc1ccc(F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
