Reaction Details |
| Report a problem with these data |
Target | Glycylpeptide N-tetradecanoyltransferase |
---|
Ligand | BDBM96235 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibition Assay |
---|
Ki | 6.9e+3±n/a nM |
---|
Citation | Sogabe, S; Masubuchi, M; Sakata, K; Fukami, TA; Morikami, K; Shiratori, Y; Ebiike, H; Kawasaki, K; Aoki, Y; Shimma, N; D'Arcy, A; Winkler, FK; Banner, DW; Ohtsuka, T Crystal structures of Candida albicans N-myristoyltransferase with two distinct inhibitors. Chem Biol9:1119-28 (2002) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Glycylpeptide N-tetradecanoyltransferase |
---|
Name: | Glycylpeptide N-tetradecanoyltransferase |
Synonyms: | 2.3.1.97 | Glycylpeptide N-tetradecanoyltransferase | Myristoyl-CoA:protein N-myristoyltransferase | Myristoyl-CoA:protein N-myristoyltransferase (Nmt D110A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt D112A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt D412A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt F115A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt F117A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt F240A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt F339A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt F339S)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt G413A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt H227A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt I111A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt I352A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt L350V)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt L451A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt L451Q)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt N175A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt P229A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt S241A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt T114A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt T211A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt V108A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt W232A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt Y107A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt Y119A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt Y225A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt Y256A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt Y354A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt) | NMT | NMT1 | NMT_CANAL | Peptide N-myristoyltransferase | Peptide N-myristoyltransferase 1 |
Type: | Enzyme |
Mol. Mass.: | 51875.96 |
Organism: | Candida albicans (Yeast) |
Description: | P30418 |
Residue: | 451 |
Sequence: | MSGDNTGNKSNSAPSKSIEELLKLLAMGQELSPAQQKEMKDYKFWKTQPVPSLSETVTEE
GPIDKLKTPEDVPNDPLPLISDFEWSTLDIDDNLQLDELYKLLYDNYVEDIDATFRFKYS
HEFFQWALKPPGWRKDWHVGVRVKSTGKLVAFIAATPVTFKLNKSNKVIDSVEINFLCIH
KKLRNKRLAPVLIKEITRRVNKQNIWQALYTGGSILPTPLTTCRYQHRPINWSKLHDVGF
SHLPPNQTKSSMVASYTLPNNPKLKGLRPMTGKDVSTVLSLLYKYQERFDIVQLFTEEEF
KHWMLGHDENSDSNVVKSYVVEDENGVITDYFSYYLLPFTVLDNAQHDELGIAYLFYYAS
DSFEKPNYKKRLNELITDALITSKKFGVDVFNCLTCQDNTYFLKDCKFGSGDGFLNYYLF
NYRTFPMDGGIDKKTKEVVEDQTSGIGVVLL
|
|
|
BDBM96235 |
---|
n/a |
---|
Name | BDBM96235 |
Synonyms: | 4-[2-hydroxy-3-(isopropylamino)propoxy]-3-methyl-coumarilic acid ethyl ester;hydrochloride | 4-[2-hydroxy-3-(propan-2-ylamino)propoxy]-3-methyl-2-benzofurancarboxylic acid ethyl ester;hydrochloride | CHEMBL53849 | MLS000039218 | Non peptidic, 1 | SMR000036354 | cid_6602742 | ethyl 3-methyl-4-[2-oxidanyl-3-(propan-2-ylamino)propoxy]-1-benzofuran-2-carboxylate;hydrochloride | ethyl 4-[2-hydroxy-3-(propan-2-ylamino)propoxy]-3-methyl-1-benzofuran-2-carboxylate;hydrochloride |
Type | Small organic molecule |
Emp. Form. | C18H25NO5 |
Mol. Mass. | 335.3948 |
SMILES | CCOC(=O)c1oc2cccc(OCC(O)CNC(C)C)c2c1C |
Structure |
|