| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 2 |
|---|
| Ligand | BDBM41656 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Counter screen for S1P2 Agonists: Dose Response High Throughput Cell-Based Screen to Identify Activators of CRE-BLA |
|---|
| EC50 | 2958±n/a nM |
|---|
| Citation |  PubChem, PC Counter screen for S1P2 Agonists: Dose Response High Throughput Cell-Based Screen to Identify Activators of CRE-BLA PubChem Bioassay(2007)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 2 |
|---|
| Name: | Sphingosine 1-phosphate receptor 2 |
|---|
| Synonyms: | EDG5 | S1P2 | S1PR2 | S1PR2_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-5 | Sphingosine-1-phosphate receptor 2 | ndothelial differentiation G-protein coupled receptor 5 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 38883.16 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Membranes isolated from S1P2-transfected CHO cells were used in ligand binding assay. |
|---|
| Residue: | 353 |
|---|
| Sequence: | MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR
NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV
FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS
TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG
VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL
RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
|
|
|
|---|
| BDBM41656 |
|---|
| n/a |
|---|
| Name | BDBM41656 |
|---|
| Synonyms: | 4-keto-9,10-dimethoxy-2,3,6,7-tetrahydrobenzo[a]quinolizine-1-carbonitrile | 9,10-dimethoxy-4-oxidanylidene-2,3,6,7-tetrahydrobenzo[a]quinolizine-1-carbonitrile | 9,10-dimethoxy-4-oxo-2,3,6,7-tetrahydrobenzo[a]quinolizine-1-carbonitrile | 9,10-dimethoxy-4-oxo-3,4,6,7-tetrahydro-2H-pyrido[2,1-a]isoquinoline-1-carbonitrile | MLS000097043 | SMR000075687 | cid_977094 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H16N2O3 |
|---|
| Mol. Mass. | 284.3098 |
|---|
| SMILES | COc1cc2CCN3C(=O)CCC(C#N)=C3c2cc1OC |c:14| |
|---|
| Structure | 
|
|---|
Search and Browse
