| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Glutathione S-transferase Mu 1 |
|---|
| Ligand | BDBM32330 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Profiling Assay to determine GST-GSH interactions in multiplex bead-based assays (HPSMTB buffer) |
|---|
| EC50 | 4780±n/a nM |
|---|
| Citation |  PubChem, PC Profiling Assay to determine GST-GSH interactions in multiplex bead-based assays (HPSMTB buffer) PubChem Bioassay(2008)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Glutathione S-transferase Mu 1 |
|---|
| Name: | Glutathione S-transferase Mu 1 |
|---|
| Synonyms: | GST class-mu 1 | GST1 | GSTM1 | GSTM1-1 | GSTM1_HUMAN | GSTM1a-1a | GSTM1b-1b | GTH4 | Glutathione S-transferase Mu 1 | HB subunit 4 | glutathione S-transferase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 25712.03 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_799596 |
|---|
| Residue: | 218 |
|---|
| Sequence: | MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF
EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
|
|
|
|---|
| BDBM32330 |
|---|
| n/a |
|---|
| Name | BDBM32330 |
|---|
| Synonyms: | (2Z)-2-(5-fluoranyl-2-oxidanylidene-indol-3-yl)-2-(4-methyl-3H-1,3-thiazol-2-ylidene)ethanenitrile | (2Z)-2-(5-fluoro-2-keto-indol-3-yl)-2-(4-methyl-4-thiazolin-2-ylidene)acetonitrile | (2Z)-2-(5-fluoro-2-oxo-3-indolyl)-2-(4-methyl-3H-thiazol-2-ylidene)acetonitrile | (2Z)-2-(5-fluoro-2-oxoindol-3-yl)-2-(4-methyl-3H-1,3-thiazol-2-ylidene)acetonitrile | MLS001011168 | SMR000353171 | cid_16196155 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H8FN3OS |
|---|
| Mol. Mass. | 285.296 |
|---|
| SMILES | Cc1csc(n1)C(C#N)=C1C(=O)Nc2ccc(F)cc12 |w:9.20| |
|---|
| Structure | 
|
|---|
Search and Browse
