| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-like protein 10 [11-204] |
|---|
| Ligand | BDBM32303 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-B protein. |
|---|
| EC50 | 1510±n/a nM |
|---|
| Citation |  PubChem, PC Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-B protein. PubChem Bioassay(2008)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Bcl-2-like protein 10 [11-204] |
|---|
| Name: | Bcl-2-like protein 10 [11-204] |
|---|
| Synonyms: | Apoptosis regulator Bcl-B (Bcl-2-like 10 protein) (Bcl2-L-10) (Anti-apoptotic protein NrH). | B2L10_HUMAN | BCL-B | BCL2L10 | BCLB | BOO | DIVA |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 21981.77 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_23396469 |
|---|
| Residue: | 194 |
|---|
| Sequence: | MADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGY
PGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQ
EGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSC
LLTTAFIYLWTRLL
|
|
|
|---|
| BDBM32303 |
|---|
| n/a |
|---|
| Name | BDBM32303 |
|---|
| Synonyms: | 4-chloro-3-nitro-benzoic acid [6-[[(4,6-dimethylpyrimidin-2-yl)thio]methyl]-4-keto-pyran-3-yl] ester | 4-chloro-3-nitrobenzoic acid [6-[[(4,6-dimethyl-2-pyrimidinyl)thio]methyl]-4-oxo-3-pyranyl] ester | MLS000696800 | SMR000237278 | [6-[(4,6-dimethylpyrimidin-2-yl)sulfanylmethyl]-4-oxidanylidene-pyran-3-yl] 4-chloranyl-3-nitro-benzoate | [6-[(4,6-dimethylpyrimidin-2-yl)sulfanylmethyl]-4-oxopyran-3-yl] 4-chloro-3-nitrobenzoate | cid_12005789 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H14ClN3O6S |
|---|
| Mol. Mass. | 447.849 |
|---|
| SMILES | Cc1cc(C)nc(SCc2cc(=O)c(OC(=O)c3ccc(Cl)c(c3)[N+]([O-])=O)co2)n1 |
|---|
| Structure | 
|
|---|
Search and Browse
