| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-like protein 2 |
|---|
| Ligand | BDBM33127 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Multiplexed dose response screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-W. |
|---|
| EC50 | 4340±n/a nM |
|---|
| Citation |  PubChem, PC Multiplexed dose response screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-W. PubChem Bioassay(2008)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Bcl-2-like protein 2 |
|---|
| Name: | Bcl-2-like protein 2 |
|---|
| Synonyms: | Apoptosis regulator Bcl-W | B2CL2_HUMAN | BCL-W | BCL2L2 | BCLW | Bcl-2-like protein 2 | Bcl2-L-2 | KIAA0271 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 20742.61 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 193 |
|---|
| Sequence: | MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRT
FSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVG
QVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVAL
GALVTVGAFFASK
|
|
|
|---|
| BDBM33127 |
|---|
| n/a |
|---|
| Name | BDBM33127 |
|---|
| Synonyms: | MLS000392290 | N-[3-(3-chloro-4-methyl-anilino)-1,4-diketo-2-naphthyl]benzamide | N-[3-(3-chloro-4-methylanilino)-1,4-dioxo-2-naphthalenyl]benzamide | N-[3-(3-chloro-4-methylanilino)-1,4-dioxonaphthalen-2-yl]benzamide | N-[3-[(3-chloranyl-4-methyl-phenyl)amino]-1,4-bis(oxidanylidene)naphthalen-2-yl]benzamide | SMR000261286 | cid_5082182 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H17ClN2O3 |
|---|
| Mol. Mass. | 416.856 |
|---|
| SMILES | Cc1ccc(NC2=C(NC(=O)c3ccccc3)C(=O)c3ccccc3C2=O)cc1Cl |c:6| |
|---|
| Structure | 
|
|---|
Search and Browse
