| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Signal transducer and activator of transcription 3 [702-738,740-752] |
|---|
| Ligand | BDBM46356 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose response cell-based assay to measure STAT3 inhibition |
|---|
| IC50 | 700±n/a nM |
|---|
| Citation |  PubChem, PC Dose response cell-based assay to measure STAT3 inhibition PubChem Bioassay(2008)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Signal transducer and activator of transcription 3 [702-738,740-752] |
|---|
| Name: | Signal transducer and activator of transcription 3 [702-738,740-752] |
|---|
| Synonyms: | APRF | STAT3 | STAT3_HUMAN |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 5263.93 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_13272532 |
|---|
| Residue: | 50 |
|---|
| Sequence: | AAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNGEGAEPSAGGQF
|
|
|
|---|
| BDBM46356 |
|---|
| n/a |
|---|
| Name | BDBM46356 |
|---|
| Synonyms: | DIGITOXIN | MLS000069787 | SMR000058529 | US10668094, Compound Digitoxin | cid_441207 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C41H64O13 |
|---|
| Mol. Mass. | 764.9391 |
|---|
| SMILES | C[C@H]1O[C@H](C[C@H](O)[C@@H]1O)O[C@H]1[C@@H](O)C[C@H](O[C@H]2[C@@H](O)C[C@H](O[C@H]3CC[C@@]4(C)[C@H](CC[C@@H]5[C@@H]4CC[C@]4(C)[C@H](CC[C@]54O)C4=CC(=O)OC4)C3)O[C@@H]2C)O[C@@H]1C |t:45| |
|---|
| Structure | 
|
|---|
Search and Browse
