| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Regulator of G-protein signaling 8 |
|---|
| Ligand | BDBM34336 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose respone, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS8-Galphao. |
|---|
| EC50 | 5080±n/a nM |
|---|
| Citation |  PubChem, PC Dose respone, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS8-Galphao. PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Regulator of G-protein signaling 8 |
|---|
| Name: | Regulator of G-protein signaling 8 |
|---|
| Synonyms: | RGS8 | RGS8_HUMAN | Regulator of G-protein signaling 8 (RGS8) |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 20925.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_74355113 |
|---|
| Residue: | 180 |
|---|
| Sequence: | MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVL
LSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPRE
VNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS
|
|
|
|---|
| BDBM34336 |
|---|
| n/a |
|---|
| Name | BDBM34336 |
|---|
| Synonyms: | 2-(2-morpholin-4-yl-5-morpholin-4-ylsulfonyl-phenyl)-1,2-benzothiazol-3-one | 2-(2-morpholin-4-yl-5-morpholin-4-ylsulfonylphenyl)-1,2-benzothiazol-3-one | 2-(2-morpholino-5-morpholinosulfonyl-phenyl)-1,2-benzothiazol-3-one | 2-[2-(4-morpholinyl)-5-(4-morpholinylsulfonyl)phenyl]-1,2-benzothiazol-3-one | MLS000055722 | SMR000060745 | cid_2325815 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H23N3O5S2 |
|---|
| Mol. Mass. | 461.554 |
|---|
| SMILES | O=c1n(sc2ccccc12)-c1cc(ccc1N1CCOCC1)S(=O)(=O)N1CCOCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
