new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRegulator of G-protein signaling 8
LigandBDBM47815
Substrate/Competitorn/a
Meas. Tech.Dose respone, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS8-Galphao.
EC50 7260±n/a nM
Citation PubChem PC Dose respone, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS8-Galphao. PubChem Bioassay (2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Regulator of G-protein signaling 8
Name:Regulator of G-protein signaling 8
Synonyms:Regulator of G-protein signaling 8 (RGS8)
Type:Enzyme Catalytic Domain
Mol. Mass.:20925.80
Organism:Homo sapiens (Human)
Description:gi_74355113
Residue:180
Sequence:
MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVL
LSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPRE
VNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM47815
n/a
NameBDBM47815
Synonyms:2-(4-Methoxy-phenyl)-[1,4]benzoquinone | 2-(4-methoxyphenyl)-p-benzoquinone | 2-(4-methoxyphenyl)cyclohexa-2,5-diene-1,4-dione | MLS001029846 | SMR000427749 | cid_121637
TypeSmall organic molecule
Emp. Form.C13H10O3
Mol. Mass.214.2167
SMILESCOc1ccc(cc1)C1=CC(=O)C=CC1=O |c:13,t:9|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: