| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Regulator of G-protein signaling 8 |
|---|
| Ligand | BDBM47823 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose respone, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS8-Galphao. |
|---|
| EC50 | 3420±n/a nM |
|---|
| Citation |  PubChem, PC Dose respone, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS8-Galphao. PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Regulator of G-protein signaling 8 |
|---|
| Name: | Regulator of G-protein signaling 8 |
|---|
| Synonyms: | RGS8 | RGS8_HUMAN | Regulator of G-protein signaling 8 (RGS8) |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 20925.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_74355113 |
|---|
| Residue: | 180 |
|---|
| Sequence: | MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVL
LSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPRE
VNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS
|
|
|
|---|
| BDBM47823 |
|---|
| n/a |
|---|
| Name | BDBM47823 |
|---|
| Synonyms: | MLS000757112 | N-(2,5-dichloro-3,6-diketo-4-propionamido-cyclohexa-1,4-dien-1-yl)propionamide | N-[2,5-bis(chloranyl)-3,6-bis(oxidanylidene)-4-(propanoylamino)cyclohexa-1,4-dien-1-yl]propanamide | N-[2,5-dichloro-3,6-dioxo-4-(1-oxopropylamino)-1-cyclohexa-1,4-dienyl]propanamide | N-[2,5-dichloro-3,6-dioxo-4-(propanoylamino)cyclohexa-1,4-dien-1-yl]propanamide | SMR000528879 | cid_323616 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H12Cl2N2O4 |
|---|
| Mol. Mass. | 319.141 |
|---|
| SMILES | CCC(=O)NC1=C(Cl)C(=O)C(NC(=O)CC)=C(Cl)C1=O |c:5,t:15| |
|---|
| Structure | 
|
|---|
Search and Browse
