new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRGS7
LigandBDBM34513
Substrate/Competitorn/a
Meas. Tech.Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS7-Galphao.
EC50 4060±n/a nM
Citation PubChem PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS7-Galphao. PubChem Bioassay (2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
RGS7
Name:RGS7
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:57675.72
Organism:Homo sapiens (Human)
Description:P49802
Residue:495
Sequence:
MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGS
DIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNC
WEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKK
RDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSH
SPTHTPTPETKPPTEDELQQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYLEYDPFLLPP
DPSNPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENL
RFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFE
DAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKKSGNSMDRRTSFEKFAQNVGRNIPIFPC
HKNCTPTLRASTNLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM34513
n/a
NameBDBM34513
Synonyms:MLS000118887 | N-[2-(2,5-dimethoxyphenyl)ethyl]-2-(3-keto-4,6-dimethyl-isothiazolo[5,4-b]pyridin-2-yl)acetamide | N-[2-(2,5-dimethoxyphenyl)ethyl]-2-(4,6-dimethyl-3-oxidanylidene-[1,2]thiazolo[5,4-b]pyridin-2-yl)ethanamide | N-[2-(2,5-dimethoxyphenyl)ethyl]-2-(4,6-dimethyl-3-oxo-2-isothiazolo[5,4-b]pyridinyl)acetamide | N-[2-(2,5-dimethoxyphenyl)ethyl]-2-(4,6-dimethyl-3-oxo-[1,2]thiazolo[5,4-b]pyridin-2-yl)acetamide | SMR000095827 | US9011882, Table 1, Compound 15 | cid_5309169
TypeSmall organic molecule
Emp. Form.C20H23N3O4S
Mol. Mass.401.479
SMILESCOc1ccc(OC)c(CCNC(=O)Cn2sc3nc(C)cc(C)c3c2=O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: