| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Glycoprotein 42 |
|---|
| Ligand | BDBM31712 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose Response Confirmation for Small Molecule Inhibitors of Epstein-Barr Virus |
|---|
| IC50 | 5590±n/a nM |
|---|
| Citation |  PubChem, PC Dose Response Confirmation for Small Molecule Inhibitors of Epstein-Barr Virus PubChem Bioassay(2008)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Glycoprotein 42 |
|---|
| Name: | Glycoprotein 42 |
|---|
| Synonyms: | BZLF2 | GP42_EBVA8 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25424.12 |
|---|
| Organism: | Human herpesvirus 4 type 2 |
|---|
| Description: | gi_139424501 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MVSFKQVRVPLFTAIALVIVLLLAYFLPPRVRGGGRVSAAAITWVPKPNVEVWPVDPPPP
VNFNKTAEQEYGDKEIKLPHWTPTLHTFQVPKNYTKANCTYCNTREYTFSYKERCFYFTK
KKHTWNGCFQACAELYPCTYFYGPTPDILPVVTRNLNAIESLWVGVYRVGEGNWTSLDGG
TFKVYQIFGSHCTYVSKFSTVPVSHHECSFLKPCLCVSQRSNS
|
|
|
|---|
| BDBM31712 |
|---|
| n/a |
|---|
| Name | BDBM31712 |
|---|
| Synonyms: | HEXACHLOROPHENE | Hexach-lorophene | MLS000028433 | SMR000058356 | cid_3598 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H6Cl6O2 |
|---|
| Mol. Mass. | 406.904 |
|---|
| SMILES | Oc1c(Cl)cc(Cl)c(Cl)c1Cc1c(O)c(Cl)cc(Cl)c1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
