| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Glycoprotein 42 |
|---|
| Ligand | BDBM50925 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose Response Confirmation for Small Molecule Inhibitors of Epstein-Barr Virus |
|---|
| IC50 | 3700±n/a nM |
|---|
| Citation |  PubChem, PC Dose Response Confirmation for Small Molecule Inhibitors of Epstein-Barr Virus PubChem Bioassay(2008)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Glycoprotein 42 |
|---|
| Name: | Glycoprotein 42 |
|---|
| Synonyms: | BZLF2 | GP42_EBVA8 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25424.12 |
|---|
| Organism: | Human herpesvirus 4 type 2 |
|---|
| Description: | gi_139424501 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MVSFKQVRVPLFTAIALVIVLLLAYFLPPRVRGGGRVSAAAITWVPKPNVEVWPVDPPPP
VNFNKTAEQEYGDKEIKLPHWTPTLHTFQVPKNYTKANCTYCNTREYTFSYKERCFYFTK
KKHTWNGCFQACAELYPCTYFYGPTPDILPVVTRNLNAIESLWVGVYRVGEGNWTSLDGG
TFKVYQIFGSHCTYVSKFSTVPVSHHECSFLKPCLCVSQRSNS
|
|
|
|---|
| BDBM50925 |
|---|
| n/a |
|---|
| Name | BDBM50925 |
|---|
| Synonyms: | 5-methyl-4-phenyl-cyclopenta[c]quinolizine-1,2-dicarboxylic acid dimethyl ester | 5-methyl-4-phenylcyclopenta[c]quinolizine-1,2-dicarboxylic acid dimethyl ester | MLS000537611 | SMR000161420 | cid_990753 | dimethyl 5-methyl-4-phenyl-cyclopenta[c]quinolizine-1,2-dicarboxylate | dimethyl 5-methyl-4-phenylcyclopenta[c]quinolizine-1,2-dicarboxylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H19NO4 |
|---|
| Mol. Mass. | 373.4013 |
|---|
| SMILES | COC(=O)c1cc2c(-c3ccccc3)c(C)c3ccccn3c2c1C(=O)OC |
|---|
| Structure | 
|
|---|
Search and Browse
