Reaction Details |
| Report a problem with these data |
Target | Regulator of G-protein signaling 4 |
---|
Ligand | BDBM47816 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS4-Galphao. |
---|
EC50 | 3080±n/a nM |
---|
Citation | PubChem, PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS4-Galphao. PubChem Bioassay(2009)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Regulator of G-protein signaling 4 |
---|
Name: | Regulator of G-protein signaling 4 |
Synonyms: | RGP4 | RGS4 | RGS4_HUMAN | Regulator of G-protein signaling 4 (RGS4) |
Type: | Enzyme |
Mol. Mass.: | 23263.51 |
Organism: | Homo sapiens (Human) |
Description: | P49798 |
Residue: | 205 |
Sequence: | MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWA
ESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNP
SSCGAEKQKGAKSSADCASLVPQCA
|
|
|
BDBM47816 |
---|
n/a |
---|
Name | BDBM47816 |
Synonyms: | 6-Oxo-6H-anthra[1,9-cd]isoxazole-3-carboxylic acid (3-methoxy-propyl)-amide | MLS001029502 | SMR000425486 | cid_3729555 |
Type | Small organic molecule |
Emp. Form. | C19H16N2O4 |
Mol. Mass. | 336.3413 |
SMILES | COCCCNC(=O)c1ccc2C(=O)c3ccccc3-c3onc1c23 |
Structure |
|