Reaction Details |
| Report a problem with these data |
Target | Dual specificity protein phosphatase 3 |
---|
Ligand | BDBM43224 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Fluorescent assay for identification of compounds that inhibit VHR1 |
---|
IC50 | 106000±n/a nM |
---|
Citation | PubChem, PC Fluorescent assay for identification of compounds that inhibit VHR1 PubChem Bioassay(2009)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dual specificity protein phosphatase 3 |
---|
Name: | Dual specificity protein phosphatase 3 |
Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
Type: | Hydrolase |
Mol. Mass.: | 20480.58 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 185 |
Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
BDBM43224 |
---|
n/a |
---|
Name | BDBM43224 |
Synonyms: | 1-ethyl-6-methyl-3-[(E)-2-phenylethenyl]pyrimido[5,4-e][1,2,4]triazine-5,7-dione | 1-ethyl-6-methyl-3-[(E)-styryl]pyrimido[5,4-e][1,2,4]triazine-5,7-quinone | MLS000717146 | SMR000278513 | US9073941, 609 | cid_5756371 |
Type | Small organic molecule |
Emp. Form. | C16H15N5O2 |
Mol. Mass. | 309.3226 |
SMILES | CCn1nc(\C=C\c2ccccc2)nc2c1nc(=O)n(C)c2=O |
Structure |
|