| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase ESS1 |
|---|
| Ligand | BDBM53402 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Pin1 Inhibition Assay |
|---|
| pH | 7±0 |
|---|
| Temperature | 273.15±n/a K |
|---|
| IC50 | 1.5e+3±n/a nM |
|---|
| Citation |  Uchida, T; Takamiya, M; Takahashi, M; Miyashita, H; Ikeda, H; Terada, T; Matsuo, Y; Shirouzu, M; Yokoyama, S; Fujimori, F; Hunter, T Pin1 and Par14 peptidyl prolyl isomerase inhibitors block cell proliferation. Chem Biol10:15-24 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase ESS1 |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase ESS1 |
|---|
| Synonyms: | ESS1 | ESS1_YEAST | PIN1 | PTF1 | Parvulin ESS1 | Peptidyl-prolyl cis-trans isomerase |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 19411.52 |
|---|
| Organism: | Saccharomyces cerevisiae (Baker's yeast) |
|---|
| Description: | P22696 |
|---|
| Residue: | 170 |
|---|
| Sequence: | MPSDVASRTGLPTPWTVRYSKSKKREYFFNPETKHSQWEEPEGTNKDQLHKHLRDHPVRV
RCLHILIKHKDSRRPASHRSENITISKQDATDELKTLITRLDDDSKTNSFEALAKERSDC
SSYKRGGDLGWFGRGEMQPSFEDAAFQLKVGEVSDIVESGSGVHVIKRVG
|
|
|
|---|
| BDBM53402 |
|---|
| n/a |
|---|
| Name | BDBM53402 |
|---|
| Synonyms: | (3R,3aR,7aR)-2-benzyl-3-(1-bromo-2-naphthyl)-7a-methyl-3,3a,6,7-tetrahydroisoindol-1-one | (3R,3aR,7aR)-2-benzyl-3-(1-bromonaphthalen-2-yl)-7a-methyl-3,3a,6,7-tetrahydroisoindol-1-one | (3R,3aR,7aR)-3-(1-bromanylnaphthalen-2-yl)-7a-methyl-2-(phenylmethyl)-3,3a,6,7-tetrahydroisoindol-1-one | (3R,3aR,7aR)-3-(1-bromo-2-naphthalenyl)-7a-methyl-2-(phenylmethyl)-3,3a,6,7-tetrahydroisoindol-1-one | MLS000882836 | PiB | SMR000465414 | cid_16060474 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H24BrNO |
|---|
| Mol. Mass. | 446.379 |
|---|
| SMILES | C[C@@]12CCC=C[C@H]1[C@@H](N(Cc1ccccc1)C2=O)c1ccc2ccccc2c1Br |c:4| |
|---|
| Structure | 
|
|---|
Search and Browse
