Reaction Details |
| Report a problem with these data |
Target | Ras-related protein Rab-7a |
---|
Ligand | BDBM54555 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Oxadiazole SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Rab7 wildtype |
---|
EC50 | 7852±n/a nM |
---|
Citation | PubChem, PC Oxadiazole SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Rab7 wildtype PubChem Bioassay(2009)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Ras-related protein Rab-7a |
---|
Name: | Ras-related protein Rab-7a |
Synonyms: | GTP-binding protein (rab7) | RAB7 | RAB7A | RAB7A_CANLF |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 23519.50 |
Organism: | Canis lupus familiaris |
Description: | gi_164058 |
Residue: | 207 |
Sequence: | MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ
IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF
VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV
ELYNEFPEPIKLDKNDRAKTSAESCSC
|
|
|
BDBM54555 |
---|
n/a |
---|
Name | BDBM54555 |
Synonyms: | 1-[4-(2,5-dimethylphenyl)-1-piperazinyl]-3-[3-(3-fluorophenyl)-1,2,4-oxadiazol-5-yl]-1-propanone | 1-[4-(2,5-dimethylphenyl)piperazin-1-yl]-3-[3-(3-fluorophenyl)-1,2,4-oxadiazol-5-yl]propan-1-one | 1-[4-(2,5-dimethylphenyl)piperazino]-3-[3-(3-fluorophenyl)-1,2,4-oxadiazol-5-yl]propan-1-one | KUC103366N | UNM-0000306076 | cid_42596904 |
Type | Small organic molecule |
Emp. Form. | C23H25FN4O2 |
Mol. Mass. | 408.4686 |
SMILES | Cc1ccc(C)c(c1)N1CCN(CC1)C(=O)CCc1nc(no1)-c1cccc(F)c1 |
Structure |
|