| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ras-related C3 botulinum toxin substrate 1 |
|---|
| Ligand | BDBM50218896 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Additional SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Rac1 wildtype |
|---|
| EC50 | 34594±n/a nM |
|---|
| Citation |  PubChem, PC Additional SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Rac1 wildtype PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Ras-related C3 botulinum toxin substrate 1 |
|---|
| Name: | Ras-related C3 botulinum toxin substrate 1 |
|---|
| Synonyms: | RAC1_MOUSE | Rac1 | Rac1 protein |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 21455.91 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | EBI_101485 |
|---|
| Residue: | 192 |
|---|
| Sequence: | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
|
|
|
|---|
| BDBM50218896 |
|---|
| n/a |
|---|
| Name | BDBM50218896 |
|---|
| Synonyms: | 7-fluoroindirubin | CHEMBL243986 | cid_11847138 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H9FN2O2 |
|---|
| Mol. Mass. | 280.2533 |
|---|
| SMILES | Fc1cccc2C(C(=O)Nc12)=C1Nc2ccccc2C1=O |w:11.13| |
|---|
| Structure | 
|
|---|
Search and Browse
