Reaction Details |
| Report a problem with these data |
Target | Ras-related C3 botulinum toxin substrate 1 |
---|
Ligand | BDBM54693 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Additional SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Rac1 wildtype |
---|
Ki | 230±n/a nM |
---|
Citation | PubChem, PC Additional SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Rac1 wildtype PubChem Bioassay(2009)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Ras-related C3 botulinum toxin substrate 1 |
---|
Name: | Ras-related C3 botulinum toxin substrate 1 |
Synonyms: | RAC1_MOUSE | Rac1 | Rac1 protein |
Type: | PROTEIN |
Mol. Mass.: | 21455.91 |
Organism: | Mus musculus |
Description: | EBI_101485 |
Residue: | 192 |
Sequence: | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
|
|
|
BDBM54693 |
---|
n/a |
---|
Name | BDBM54693 |
Synonyms: | UNM-0000305812 | cid_23675324 | sodium;(2R)-2-(6-methoxy-2-naphthalenyl)propanoate | sodium;(2R)-2-(6-methoxy-2-naphthyl)propionate | sodium;(2R)-2-(6-methoxynaphthalen-2-yl)propanoate |
Type | Small organic molecule |
Emp. Form. | C14H13O3 |
Mol. Mass. | 229.2518 |
SMILES | COc1ccc2cc(ccc2c1)[C@@H](C)C([O-])=O |
Structure |
|