| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ras-related protein Rab-7a |
|---|
| Ligand | BDBM54644 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Pyrazoline SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Rab7 wildtype |
|---|
| EC50 | 30000±n/a nM |
|---|
| Citation |  PubChem, PC Pyrazoline SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Rab7 wildtype PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Ras-related protein Rab-7a |
|---|
| Name: | Ras-related protein Rab-7a |
|---|
| Synonyms: | GTP-binding protein (rab7) | RAB7 | RAB7A | RAB7A_CANLF |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 23519.50 |
|---|
| Organism: | Canis lupus familiaris |
|---|
| Description: | gi_164058 |
|---|
| Residue: | 207 |
|---|
| Sequence: | MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ
IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF
VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV
ELYNEFPEPIKLDKNDRAKTSAESCSC
|
|
|
|---|
| BDBM54644 |
|---|
| n/a |
|---|
| Name | BDBM54644 |
|---|
| Synonyms: | 4-[3-(3-methoxyphenyl)-5-(4-methoxyphenyl)-2-pyrazolin-1-yl]benzenesulfonamide | 4-[5-(3-methoxyphenyl)-3-(4-methoxyphenyl)-3,4-dihydropyrazol-2-yl]benzenesulfonamide | KUC103420N | UNM-0000306139 | cid_44143698 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H23N3O4S |
|---|
| Mol. Mass. | 437.511 |
|---|
| SMILES | COc1ccc(cc1)C1CC(=NN1c1ccc(cc1)S(N)(=O)=O)c1cccc(OC)c1 |c:11| |
|---|
| Structure | 
|
|---|
Search and Browse
