| Reaction Details |
|---|
 | Report a problem with these data |
| Target | GTPase KRas [1-37] |
|---|
| Ligand | BDBM54544 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Oxadiazole SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Ras activated mutant |
|---|
| EC50 | 30000±n/a nM |
|---|
| Citation |  PubChem, PC Oxadiazole SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Ras activated mutant PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| GTPase KRas [1-37] |
|---|
| Name: | GTPase KRas [1-37] |
|---|
| Synonyms: | ras protein |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 4034.04 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_190938 |
|---|
| Residue: | 37 |
|---|
| Sequence: | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIE
|
|
|
|---|
| BDBM54544 |
|---|
| n/a |
|---|
| Name | BDBM54544 |
|---|
| Synonyms: | 3-[3-(4-methoxyphenyl)-1,2,4-oxadiazol-5-yl]-1-(4-phenyl-1-piperazinyl)-1-propanone | 3-[3-(4-methoxyphenyl)-1,2,4-oxadiazol-5-yl]-1-(4-phenylpiperazin-1-yl)propan-1-one | 3-[3-(4-methoxyphenyl)-1,2,4-oxadiazol-5-yl]-1-(4-phenylpiperazino)propan-1-one | KUC103350N | UNM-0000306064 | cid_22107972 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H24N4O3 |
|---|
| Mol. Mass. | 392.451 |
|---|
| SMILES | COc1ccc(cc1)-c1noc(CCC(=O)N2CCN(CC2)c2ccccc2)n1 |
|---|
| Structure | 
|
|---|
Search and Browse
