| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ras-related protein Rab-2A |
|---|
| Ligand | BDBM54612 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Pyrazoline SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Rab2 wildtype |
|---|
| EC50 | 30000±n/a nM |
|---|
| Comments | Extracted from aid = 2045 and tid = 2 |
|---|
| Citation |  PubChem, PC Pyrazoline SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Rab2 wildtype PubChem Bioassay(2016)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Ras-related protein Rab-2A |
|---|
| Name: | Ras-related protein Rab-2A |
|---|
| Synonyms: | RAB2 | RAB2A | RAB2A_CANLF | Ras-related protein Rab-2A. |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 23545.28 |
|---|
| Organism: | Canis lupus familiaris |
|---|
| Description: | gi_46577642 |
|---|
| Residue: | 212 |
|---|
| Sequence: | MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIW
DTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNK
SDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINN
EANGIKIGPQHAATNATHAGNQGGQQAGGGCC
|
|
|
|---|
| BDBM54612 |
|---|
| n/a |
|---|
| Name | BDBM54612 |
|---|
| Synonyms: | 2-[4-[bis(fluoranyl)methylsulfonyl]phenyl]-5-(4-bromophenyl)-3-phenyl-3,4-dihydropyrazole | 3-(4-bromophenyl)-1-[4-(difluoromethylsulfonyl)phenyl]-5-phenyl-2-pyrazoline | 5-(4-bromophenyl)-2-[4-(difluoromethylsulfonyl)phenyl]-3-phenyl-3,4-dihydropyrazole | UNM-0000305851 | cid_2865099 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H17BrF2N2O2S |
|---|
| Mol. Mass. | 491.348 |
|---|
| SMILES | FC(F)S(=O)(=O)c1ccc(cc1)N1N=C(CC1c1ccccc1)c1ccc(Br)cc1 |c:14| |
|---|
| Structure | 
|
|---|
Search and Browse
