| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ras-related protein Rab-2A |
|---|
| Ligand | BDBM54675 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Additional SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Rab2 wildtype |
|---|
| EC50 | 30000±n/a nM |
|---|
| Citation |  PubChem, PC Additional SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Rab2 wildtype PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Ras-related protein Rab-2A |
|---|
| Name: | Ras-related protein Rab-2A |
|---|
| Synonyms: | RAB2 | RAB2A | RAB2A_CANLF | Ras-related protein Rab-2A. |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 23545.28 |
|---|
| Organism: | Canis lupus familiaris |
|---|
| Description: | gi_46577642 |
|---|
| Residue: | 212 |
|---|
| Sequence: | MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIW
DTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNK
SDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINN
EANGIKIGPQHAATNATHAGNQGGQQAGGGCC
|
|
|
|---|
| BDBM54675 |
|---|
| n/a |
|---|
| Name | BDBM54675 |
|---|
| Synonyms: | (5Z)-5-(2-ketoindolin-3-ylidene)hydantoin | (5Z)-5-(2-oxidanylidene-1H-indol-3-ylidene)imidazolidine-2,4-dione | (5Z)-5-(2-oxo-1H-indol-3-ylidene)imidazolidine-2,4-dione | UNM-0000305761 | cid_15716919 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H7N3O3 |
|---|
| Mol. Mass. | 229.1916 |
|---|
| SMILES | O=C1NC(=O)\C(N1)=C1\C(=O)Nc2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
