| Reaction Details |
|---|
 | Report a problem with these data |
| Target | GTPase KRas [1-37] |
|---|
| Ligand | BDBM54589 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Pyrazoline SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Ras activated mutant |
|---|
| EC50 | 30000±n/a nM |
|---|
| Citation |  PubChem, PC Pyrazoline SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Ras activated mutant PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| GTPase KRas [1-37] |
|---|
| Name: | GTPase KRas [1-37] |
|---|
| Synonyms: | ras protein |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 4034.04 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_190938 |
|---|
| Residue: | 37 |
|---|
| Sequence: | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIE
|
|
|
|---|
| BDBM54589 |
|---|
| n/a |
|---|
| Name | BDBM54589 |
|---|
| Synonyms: | 1-(4-bromophenyl)-3,5-diphenyl-2-pyrazoline | 2-(4-bromophenyl)-3,5-diphenyl-3,4-dihydropyrazole | UNM-0000305827 | cid_2827632 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H17BrN2 |
|---|
| Mol. Mass. | 377.277 |
|---|
| SMILES | Brc1ccc(cc1)N1N=C(CC1c1ccccc1)c1ccccc1 |c:9| |
|---|
| Structure | 
|
|---|
Search and Browse
