Reaction Details |
| Report a problem with these data |
Target | Bcl-2-like protein 10 [11-204] |
---|
Ligand | BDBM33087 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Confirmation dose response of hits from multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-B |
---|
EC50 | 31590±n/a nM |
---|
Citation | PubChem, PC Confirmation dose response of hits from multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-B PubChem Bioassay(2009)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Bcl-2-like protein 10 [11-204] |
---|
Name: | Bcl-2-like protein 10 [11-204] |
Synonyms: | Apoptosis regulator Bcl-B (Bcl-2-like 10 protein) (Bcl2-L-10) (Anti-apoptotic protein NrH). | B2L10_HUMAN | BCL-B | BCL2L10 | BCLB | BOO | DIVA |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 21981.77 |
Organism: | Homo sapiens (Human) |
Description: | gi_23396469 |
Residue: | 194 |
Sequence: | MADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGY
PGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQ
EGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSC
LLTTAFIYLWTRLL
|
|
|
BDBM33087 |
---|
n/a |
---|
Name | BDBM33087 |
Synonyms: | 2,3-bis(2-furanyl)-N-(phenylmethyl)-6-quinoxalinecarboxamide | 2,3-bis(furan-2-yl)-N-(phenylmethyl)quinoxaline-6-carboxamide | MLS000534716 | N-benzyl-2,3-bis(2-furyl)quinoxaline-6-carboxamide | N-benzyl-2,3-bis(furan-2-yl)quinoxaline-6-carboxamide | N-benzyl-2,3-di-2-furyl-6-quinoxalinecarboxamide | SMR000142133 | cid_1329592 |
Type | Small organic molecule |
Emp. Form. | C24H17N3O3 |
Mol. Mass. | 395.4101 |
SMILES | O=C(NCc1ccccc1)c1ccc2nc(-c3ccco3)c(nc2c1)-c1ccco1 |
Structure |
|