| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-like protein 2 |
|---|
| Ligand | BDBM33097 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Confirmation dose response of hits from multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-W |
|---|
| EC50 | 620±n/a nM |
|---|
| Citation |  PubChem, PC Confirmation dose response of hits from multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-W PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Bcl-2-like protein 2 |
|---|
| Name: | Bcl-2-like protein 2 |
|---|
| Synonyms: | Apoptosis regulator Bcl-W | B2CL2_HUMAN | BCL-W | BCL2L2 | BCLW | Bcl-2-like protein 2 | Bcl2-L-2 | KIAA0271 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 20742.61 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 193 |
|---|
| Sequence: | MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRT
FSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVG
QVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVAL
GALVTVGAFFASK
|
|
|
|---|
| BDBM33097 |
|---|
| n/a |
|---|
| Name | BDBM33097 |
|---|
| Synonyms: | 3-[[7-(1,3-benzothiazol-2-ylsulfanyl)-4-nitro-2,1,3-benzoxadiazol-5-yl]amino]propyl acetate | 3-[[7-(1,3-benzothiazol-2-ylsulfanyl)-4-nitro-2,1,3-benzoxadiazol-5-yl]amino]propyl ethanoate | MLS000521052 | SMR000131461 | acetic acid 3-[[7-(1,3-benzothiazol-2-ylthio)-4-nitro-2,1,3-benzoxadiazol-5-yl]amino]propyl ester | acetic acid 3-[[7-(1,3-benzothiazol-2-ylthio)-4-nitro-benzofurazan-5-yl]amino]propyl ester | cid_11957209 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H15N5O5S2 |
|---|
| Mol. Mass. | 445.472 |
|---|
| SMILES | CC(=O)OCCCNc1cc(Sc2nc3ccccc3s2)c2nonc2c1[N+]([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
