new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 2
LigandBDBM54955
Substrate/Competitorn/a
Meas. Tech.SAR Compounds tested by Dose Response Screen via Multiplex HTS Assay for Inhibitors of MEK Kinase PB1 Domains, specifically MEK5 binding to MEK Kinase 2 Mutant.
EC50>30000±n/a nM
Citation PubChem PC SAR Compounds tested by Dose Response Screen via Multiplex HTS Assay for Inhibitors of MEK Kinase PB1 Domains, specifically MEK5 binding to MEK Kinase 2 Mutant. PubChem Bioassay (2009)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Mitogen-activated protein kinase 2
Name:Mitogen-activated protein kinase 2
Synonyms:2.7.11.1 | B lymphocyte serine/threonine-protein kinase | GC kinase | GCK | GCK | Germinal center kinase | MAP4K2 | MAPK/ERK kinase kinase kinase 2 | MEK kinase kinase 2 | MEKKK 2 | Mitogen-activated protein kinase kinase kinase kinase 2 | RAB8IP | Rab8-interacting protein
Type:n/a
Mol. Mass.:91551.35
Organism:Homo sapiens (Human)
Description:n/a
Residue:820
Sequence:
MALLRDVSLQDPRDRFELLQRVGAGTYGDVYKARDTVTSELAAVKIVKLDPGDDISSLQQ
EITILRECRHPNVVAYIGSYLRNDRLWICMEFCGGGSLQEIYHATGPLEERQIAYVCREA
LKGLHHLHSQGKIHRDIKGANLLLTLQGDVKLADFGVSGELTASVAKRRSFIGTPYWMAP
EVAAVERKGGYNELCDVWALGITAIELGELQPPLFHLHPMRALMLMSKSSFQPPKLRDKT
RWTQNFHHFLKLALTKNPKKRPTAEKLLQHPFTTQQLPRALLTQLLDKASDPHLGTPSPE
DCELETYDMFPDTIHSRGQHGPAERTPSEIQFHQVKFGAPRRKETDPLNEPWEEEWTLLG
KEELSGSLLQSVQEALEERSLTIRSASEFQELDSPDDTMGTIKRAPFLGPLPTDPPAEEP
LSSPPGTLPPPPSGPNSSPLLPTAWATMKQREDPERSSCHGLPPTPKVHMGACFSKVFNG
CPLRIHAAVTWIHPVTRDQFLVVGAEEGIYTLNLHELHEDTLEKLISHRCSWLYCVNNVL
LSLSGKSTHIWAHDLPGLFEQRRLQQQVPLSIPTNRLTQRIIPRRFALSTKIPDTKGCLQ
CRVVRNPYTGATFLLAALPTSLLLLQWYEPLQKFLLLKNFSSPLPSPAGMLEPLVLDGKE
LPQVCVGAEGPEGPGCRVLFHVLPLEAGLTPDILIPPEGIPGSAQQVIQVDRDTILVSFE
RCVRIVNMQGEPTATLAPELTFDFPIETVVCLQDSVLAFWSHGMQGRSLDTNEVTQEITD
ETRIFRVLGAHRDIILESIPTDNPEAHSNLYILTGHQSTY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM54955
n/a
NameBDBM54955
Synonyms:(6Z)-3-(2-pyridinyl)-6-(2-pyrrolylidene)-5H-[1,2,4]triazolo[3,4-b][1,3,4]thiadiazole | (6Z)-3-(2-pyridyl)-6-pyrrol-2-ylidene-5H-[1,2,4]triazolo[3,4-b][1,3,4]thiadiazole | (6Z)-3-pyridin-2-yl-6-pyrrol-2-ylidene-5H-[1,2,4]triazolo[3,4-b][1,3,4]thiadiazole | VU0364705-1 | cid_44236877
TypeSmall organic molecule
Emp. Form.C12H8N6S
Mol. Mass.268.297
SMILESc1c[nH]c(c1)-c1nn2c(nnc2s1)-c1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: