| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Core protein |
|---|
| Ligand | BDBM50582 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | TR-FRET-based biochemical high-throughput dose response assay to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization. |
|---|
| IC50 | >49751±n/a nM |
|---|
| Citation |  PubChem, PC TR-FRET-based biochemical high-throughput dose response assay to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization. PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Core protein |
|---|
| Name: | Core protein |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 14237.71 |
|---|
| Organism: | Hepatitis C virus |
|---|
| Description: | gi_83779224 |
|---|
| Residue: | 126 |
|---|
| Sequence: | MSTNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRG
RRQPIPKDQRTTGKSWGKPGYPWPLYGNEGLGWAGWLLSPRGSRPSWGPNDPRHRSRNVG
KVIDTL
|
|
|
|---|
| BDBM50582 |
|---|
| n/a |
|---|
| Name | BDBM50582 |
|---|
| Synonyms: | 2-(2-furanyl)-N-[4-methoxy-3-(4-morpholinylsulfonyl)phenyl]-4-quinolinecarboxamide | 2-(2-furyl)-N-(4-methoxy-3-morpholinosulfonyl-phenyl)cinchoninamide | 2-(furan-2-yl)-N-(4-methoxy-3-morpholin-4-ylsulfonyl-phenyl)quinoline-4-carboxamide | 2-(furan-2-yl)-N-(4-methoxy-3-morpholin-4-ylsulfonylphenyl)quinoline-4-carboxamide | MLS001002794 | SMR000370755 | cid_3612347 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H23N3O6S |
|---|
| Mol. Mass. | 493.532 |
|---|
| SMILES | COc1ccc(NC(=O)c2cc(nc3ccccc23)-c2ccco2)cc1S(=O)(=O)N1CCOCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
