Reaction Details |
| Report a problem with these data |
Target | G1/S-specific cyclin-D1 |
---|
Ligand | BDBM59096 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Kinase Inhibition Assay |
---|
IC50 | 4.3e+2±n/a nM |
---|
Citation | McInnes, C; Wang, S; Anderson, S; O'Boyle, J; Jackson, W; Kontopidis, G; Meades, C; Mezna, M; Thomas, M; Wood, G; Lane, DP; Fischer, PM Structural determinants of CDK4 inhibition and design of selective ATP competitive inhibitors. Chem Biol11:525-34 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
G1/S-specific cyclin-D1 |
---|
Name: | G1/S-specific cyclin-D1 |
Synonyms: | B-cell lymphoma 1 protein | BCL-1 | BCL-1 oncogene | BCL1 | CCND1 | CCND1_HUMAN | PRAD1 | PRAD1 oncogene |
Type: | Enzyme Subunit |
Mol. Mass.: | 33717.70 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 295 |
Sequence: | MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI
|
|
|
BDBM59096 |
---|
n/a |
---|
Name | BDBM59096 |
Synonyms: | Aminopyrimidine, 8 |
Type | Small organic molecule |
Emp. Form. | C21H26N6OS |
Mol. Mass. | 410.536 |
SMILES | Cc1nc(C)c(s1)-c1ccnc(Nc2ccc(cc2)N2CCN(CCO)CC2)n1 |
Structure |
|