| Reaction Details |
|---|
 | Report a problem with these data |
| Target | G1/S-specific cyclin-D1 |
|---|
| Ligand | BDBM50277583 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Kinase Inhibition Assay |
|---|
| IC50 | 2.40e+3±n/a nM |
|---|
| Citation |  McInnes, C; Wang, S; Anderson, S; O'Boyle, J; Jackson, W; Kontopidis, G; Meades, C; Mezna, M; Thomas, M; Wood, G; Lane, DP; Fischer, PM Structural determinants of CDK4 inhibition and design of selective ATP competitive inhibitors. Chem Biol11:525-34 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| G1/S-specific cyclin-D1 |
|---|
| Name: | G1/S-specific cyclin-D1 |
|---|
| Synonyms: | B-cell lymphoma 1 protein | BCL-1 | BCL-1 oncogene | BCL1 | CCND1 | CCND1_HUMAN | PRAD1 | PRAD1 oncogene |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 33717.70 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 295 |
|---|
| Sequence: | MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI
|
|
|
|---|
| BDBM50277583 |
|---|
| n/a |
|---|
| Name | BDBM50277583 |
|---|
| Synonyms: | 2-amino-4-methyl-1,3-thiazol-5-yl)-N-[4-(morpholin-4-yl)phenyl]pyrimidin-2-amine, 5 | 4-Methyl-5-(2-(4-morpholinophenylamino)pyrimidin-4-yl)thiazol-2-amine | Aminopyrimidine, 9 | CHEMBL482967 | CYC-116 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H20N6OS |
|---|
| Mol. Mass. | 368.456 |
|---|
| SMILES | Cc1nc(N)sc1-c1ccnc(Nc2ccc(cc2)N2CCOCC2)n1 |
|---|
| Structure | 
|
|---|
Search and Browse
