Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase 1 |
---|
Ligand | BDBM50256044 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | In Vitro Kinase Assay |
---|
pH | 7.2±0 |
---|
IC50 | 800±0.0 nM |
---|
Citation | Wan, Y; Hur, W; Cho, CY; Liu, Y; Adrian, FJ; Lozach, O; Bach, S; Mayer, T; Fabbro, D; Meijer, L; Gray, NS Synthesis and target identification of hymenialdisine analogs. Chem Biol11:247-59 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Cyclin-dependent kinase 1 |
---|
Name: | Cyclin-dependent kinase 1 |
Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
Type: | Enzyme Subunit |
Mol. Mass.: | 34101.08 |
Organism: | Homo sapiens (Human) |
Description: | P06493 |
Residue: | 297 |
Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
BDBM50256044 |
---|
n/a |
---|
Name | BDBM50256044 |
Synonyms: | 5-(2-amino-4-oxo-1H-imidazol-5(4H)-ylidene)-2,3,4,5-tetrahydroazepino[3,4-b]indol-1(10H)-one | CHEMBL481333 | Hymenialdisine, 27d |
Type | Small organic molecule |
Emp. Form. | C15H13N5O2 |
Mol. Mass. | 295.296 |
SMILES | NC1=NC(C(=O)N1)=C1CCNC(=O)c2[nH]c3ccccc3c12 |w:3.2,t:1| |
Structure |
|