| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dual specificity protein phosphatase 3 |
|---|
| Ligand | BDBM50696 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | uHTS absorbance assay for the identification of compounds that inhibit VHR1. |
|---|
| IC50 | 4980±n/a nM |
|---|
| Citation |  PubChem, PC uHTS absorbance assay for the identification of compounds that inhibit VHR1. PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Dual specificity protein phosphatase 3 |
|---|
| Name: | Dual specificity protein phosphatase 3 |
|---|
| Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
|---|
| Type: | Hydrolase |
|---|
| Mol. Mass.: | 20480.58 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 185 |
|---|
| Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
|---|
| BDBM50696 |
|---|
| n/a |
|---|
| Name | BDBM50696 |
|---|
| Synonyms: | 3-[5-[(1-ketothiazolo[3,2-a]benzimidazol-2-ylidene)methyl]-2-furyl]benzoic acid | 3-[5-[(1-oxidanylidene-[1,3]thiazolo[3,2-a]benzimidazol-2-ylidene)methyl]furan-2-yl]benzoic acid | 3-[5-[(1-oxo-2-thiazolo[3,2-a]benzimidazolylidene)methyl]-2-furanyl]benzoic acid | 3-[5-[(1-oxo-[1,3]thiazolo[3,2-a]benzimidazol-2-ylidene)methyl]furan-2-yl]benzoic acid | 3-{5-[3-Oxo-benzo[4,5]imidazo[2,1-b]thiazol-(2E)-ylidenemethyl]-furan-2-yl}-benzoic acid | MLS000777053 | SMR000413437 | cid_1492413 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H12N2O4S |
|---|
| Mol. Mass. | 388.396 |
|---|
| SMILES | OC(=O)c1cccc(c1)-c1ccc(C=c2sc3nc4ccccc4n3c2=O)o1 |
|---|
| Structure | 
|
|---|
Search and Browse
