| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dual specificity protein phosphatase 3 |
|---|
| Ligand | BDBM43865 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | uHTS absorbance assay for the identification of compounds that inhibit VHR1. |
|---|
| IC50 | 2060±n/a nM |
|---|
| Citation |  PubChem, PC uHTS absorbance assay for the identification of compounds that inhibit VHR1. PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Dual specificity protein phosphatase 3 |
|---|
| Name: | Dual specificity protein phosphatase 3 |
|---|
| Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
|---|
| Type: | Hydrolase |
|---|
| Mol. Mass.: | 20480.58 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 185 |
|---|
| Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
|---|
| BDBM43865 |
|---|
| n/a |
|---|
| Name | BDBM43865 |
|---|
| Synonyms: | 6-formyl-4,7-dihydroxy-9-keto-5H-phenazine-1-carboxylic acid methyl ester | 6-formyl-4,7-dihydroxy-9-oxo-5H-phenazine-1-carboxylic acid methyl ester | Glycopeptide, 4 | Lomofungin | MLS000766240 | SMR000528852 | cid_5351222 | methyl 6-formyl-4,7-dihydroxy-9-oxo-5H-phenazine-1-carboxylate | methyl 6-methanoyl-4,7-bis(oxidanyl)-9-oxidanylidene-5H-phenazine-1-carboxylate |
|---|
| Type | Peptide |
|---|
| Emp. Form. | C15H10N2O6 |
|---|
| Mol. Mass. | 314.2497 |
|---|
| SMILES | COC(=O)c1ccc(O)c2nc3c(C=O)c(O)cc(O)c3nc12 |
|---|
| Structure | 
|
|---|
Search and Browse
