| Reaction Details |
|---|
 | Report a problem with these data |
| Target | SUMO-activating enzyme subunit 1 |
|---|
| Ligand | BDBM34943 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | uHTS HTRF assay for identification of inhibitors of SUMOylation |
|---|
| IC50 | 1640±n/a nM |
|---|
| Citation |  PubChem, PC uHTS HTRF assay for identification of inhibitors of SUMOylation PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| SUMO-activating enzyme subunit 1 |
|---|
| Name: | SUMO-activating enzyme subunit 1 |
|---|
| Synonyms: | AOS1 | SAE1 | SAE1_HUMAN | SUA1 | SUMO-activating enzyme subunit 1 (SAE1) | SUMO1 activating enzyme subunit 1 | UBLE1A |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 38440.84 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_17390638 |
|---|
| Residue: | 346 |
|---|
| Sequence: | MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGV
KGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPE
SFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTK
VAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDY
FLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMA
PVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK
|
|
|
|---|
| BDBM34943 |
|---|
| n/a |
|---|
| Name | BDBM34943 |
|---|
| Synonyms: | 3-(2-hydrazino-2-keto-ethoxy)pyrid[1,2-a]indole-10-carboxylic acid ethyl ester | 3-(2-hydrazinyl-2-oxoethoxy)-10-pyrido[1,2-a]indolecarboxylic acid ethyl ester | MLS000764221 | SMR000335053 | cid_1484849 | ethyl 3-(2-diazanyl-2-oxidanylidene-ethoxy)pyrido[1,2-a]indole-10-carboxylate | ethyl 3-(2-hydrazino-2-oxoethoxy)pyrido[1,2-a]indole-10-carboxylate | ethyl 3-(2-hydrazinyl-2-oxoethoxy)pyrido[1,2-a]indole-10-carboxylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H17N3O4 |
|---|
| Mol. Mass. | 327.3346 |
|---|
| SMILES | CCOC(=O)c1c2ccc(OCC(=O)NN)cc2n2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
