| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Eukaryotic translation initiation factor 4H |
|---|
| Ligand | BDBM50578 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | uHTS fluorescence polarization assay for the identification of translation initiation inhibitors (eIF4H) |
|---|
| IC50 | 23645±n/a nM |
|---|
| Citation |  PubChem, PC uHTS fluorescence polarization assay for the identification of translation initiation inhibitors (eIF4H) PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Eukaryotic translation initiation factor 4H |
|---|
| Name: | Eukaryotic translation initiation factor 4H |
|---|
| Synonyms: | EIF4H | IF4H_HUMAN | KIAA0038 | WBSCR1 | WSCR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 27385.24 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q15056 |
|---|
| Residue: | 248 |
|---|
| Sequence: | MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDA
IFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRK
QDKGGFGFRKGGPDDRGMGSSRESRGGWDSRDDFNSGFRDDFLGGRGGSRPGDRRTGPPM
GSRFRDGPPLRGSNMDFREPTEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPRE
EVVQKEQE
|
|
|
|---|
| BDBM50578 |
|---|
| n/a |
|---|
| Name | BDBM50578 |
|---|
| Synonyms: | 3-[6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-5-phenyl-pentanoic acid | 5-phenyl-3-(3,4,5-trihydroxy-6-methylol-tetrahydropyran-2-yl)oxy-valeric acid | 5-phenyl-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxypentanoic acid | 5-phenyl-3-[[3,4,5-trihydroxy-6-(hydroxymethyl)-2-oxanyl]oxy]pentanoic acid | MLS000877001 | SMR000440688 | cid_16681750 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H24O8 |
|---|
| Mol. Mass. | 356.3677 |
|---|
| SMILES | OCC1OC(OC(CCc2ccccc2)CC(O)=O)C(O)C(O)C1O |
|---|
| Structure | 
|
|---|
Search and Browse
