| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Regulator of G-protein signaling 4 |
|---|
| Ligand | BDBM62216 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS4-Galphao for SAR compounds |
|---|
| Ki | 5830±n/a nM |
|---|
| Citation |  PubChem, PC Dose response, multiplexed high-throughput screen for small molecule regulators of RGS family protein interactions, specifically RGS4-Galphao for SAR compounds PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Regulator of G-protein signaling 4 |
|---|
| Name: | Regulator of G-protein signaling 4 |
|---|
| Synonyms: | RGP4 | RGS4 | RGS4_HUMAN | Regulator of G-protein signaling 4 (RGS4) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 23263.51 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P49798 |
|---|
| Residue: | 205 |
|---|
| Sequence: | MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWA
ESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNP
SSCGAEKQKGAKSSADCASLVPQCA
|
|
|
|---|
| BDBM62216 |
|---|
| n/a |
|---|
| Name | BDBM62216 |
|---|
| Synonyms: | 2-(4,6-dimethylisothiazolo[5,4-b]pyridin-3-yl)oxy-1-[3-methyl-4-(m-tolyl)piperazino]ethanone | 2-[(4,6-dimethyl-3-isothiazolo[5,4-b]pyridinyl)oxy]-1-[3-methyl-4-(3-methylphenyl)-1-piperazinyl]ethanone | 2-[(4,6-dimethyl-[1,2]thiazolo[5,4-b]pyridin-3-yl)oxy]-1-[3-methyl-4-(3-methylphenyl)piperazin-1-yl]ethanone | KUC103347N | UNM-0000305811 | cid_25227363 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H26N4O2S |
|---|
| Mol. Mass. | 410.532 |
|---|
| SMILES | CC1CN(CCN1c1cccc(C)c1)C(=O)COc1nsc2nc(C)cc(C)c12 |
|---|
| Structure | 
|
|---|
Search and Browse
