| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 4 |
|---|
| Ligand | BDBM46781 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Late stage fluorescence dose response cell-based screening assay for antagonists of the Sphingosine 1-Phosphate Receptor 4 (S1P4) |
|---|
| IC50 | 3697±n/a nM |
|---|
| Citation |  PubChem, PC Late stage fluorescence dose response cell-based screening assay for antagonists of the Sphingosine 1-Phosphate Receptor 4 (S1P4) PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 4 |
|---|
| Name: | Sphingosine 1-phosphate receptor 4 |
|---|
| Synonyms: | EDG6 | Endothelial differentiation G-protein coupled receptor 6 | S1P receptor 4 | S1P receptor Edg-6 | S1P4 | S1PR4 | S1PR4_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-6 | Sphingosine-1-phosphate receptor 4 | sphingosine-1-phosphate 4 S1P4 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 41647.39 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 384 |
|---|
| Sequence: | MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLV
VLENLLVLAAITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFL
REGLLFTALAASTFSLLFTAGERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLP
LLGWNCLCAFDRCSSLLPLYSKRYILFCLVIFAGVLATIMGLYGAIFRLVQASGQKAPRP
AARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS
AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDS
FRGSRSLSFRMREPLSSISSVRSI
|
|
|
|---|
| BDBM46781 |
|---|
| n/a |
|---|
| Name | BDBM46781 |
|---|
| Synonyms: | (3R,3aR)-2-benzoyl-3-(4-fluorobenzyl)-5-keto-4-methylene-1,3a-dihydrocyclopenta[c]pyrrole-3-carboxylic acid methyl ester | (3R,3aR)-2-benzoyl-3-[(4-fluorophenyl)methyl]-4-methylene-5-oxo-1,3a-dihydrocyclopenta[c]pyrrole-3-carboxylic acid methyl ester | MLS000563758 | SMR000388767 | cid_3247230 | methyl (3R,3aR)-2-benzoyl-3-[(4-fluorophenyl)methyl]-4-methylidene-5-oxo-1,3a-dihydrocyclopenta[c]pyrrole-3-carboxylate | methyl (3R,3aR)-3-[(4-fluorophenyl)methyl]-4-methylidene-5-oxidanylidene-2-(phenylcarbonyl)-1,3a-dihydrocyclopenta[c]pyrrole-3-carboxylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H20FNO4 |
|---|
| Mol. Mass. | 405.4183 |
|---|
| SMILES | COC(=O)[C@@]1(Cc2ccc(F)cc2)[C@@H]2C(CN1C(=O)c1ccccc1)=CC(=O)C2=C |c:27| |
|---|
| Structure | 
|
|---|
Search and Browse
