| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 3 |
|---|
| Ligand | BDBM62391 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Late stage counterscreen assay for S1P4 antagonists: Fluorescence dose response cell-based screening assay for antagonists of the Sphingosine 1-Phosphate Receptor 3 (S1P3) |
|---|
| IC50 | 25000±n/a nM |
|---|
| Citation |  PubChem, PC Late stage counterscreen assay for S1P4 antagonists: Fluorescence dose response cell-based screening assay for antagonists of the Sphingosine 1-Phosphate Receptor 3 (S1P3) PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 3 |
|---|
| Name: | Sphingosine 1-phosphate receptor 3 |
|---|
| Synonyms: | C9orf108 | C9orf47 | EDG3 | Endothelial differentiation G-protein coupled receptor 3 | S1P receptor 3 | S1P receptor Edg-3 | S1P3 | S1PR3 | S1PR3_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor 3 (S1P3) | Sphingosine 1-phosphate receptor Edg-3 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 42278.13 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99500 |
|---|
| Residue: | 378 |
|---|
| Sequence: | MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV
ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH
NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP
SSCIMDKNAALQNGIFCN
|
|
|
|---|
| BDBM62391 |
|---|
| n/a |
|---|
| Name | BDBM62391 |
|---|
| Synonyms: | 5-(2-chlorophenyl)-N-(2-ethyl-6-methyl-phenyl)-2-furamide | 5-(2-chlorophenyl)-N-(2-ethyl-6-methyl-phenyl)furan-2-carboxamide | 5-(2-chlorophenyl)-N-(2-ethyl-6-methylphenyl)-2-furancarboxamide | 5-(2-chlorophenyl)-N-(2-ethyl-6-methylphenyl)furan-2-carboxamide | SR-02000000235 | SR-02000000235-1 | cid_7275219 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H18ClNO2 |
|---|
| Mol. Mass. | 339.815 |
|---|
| SMILES | CCc1cccc(C)c1NC(=O)c1ccc(o1)-c1ccccc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
