| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 2 |
|---|
| Ligand | BDBM62400 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Late stage counterscreen assay for S1P4 antagonists: Fluorescence dose response cell-based screening assay for antagonists of the Sphingosine 1-Phosphate Receptor 2 (S1P2) |
|---|
| IC50 | 20740±n/a nM |
|---|
| Citation |  PubChem, PC Late stage counterscreen assay for S1P4 antagonists: Fluorescence dose response cell-based screening assay for antagonists of the Sphingosine 1-Phosphate Receptor 2 (S1P2) PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 2 |
|---|
| Name: | Sphingosine 1-phosphate receptor 2 |
|---|
| Synonyms: | EDG5 | S1P2 | S1PR2 | S1PR2_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-5 | Sphingosine-1-phosphate receptor 2 | ndothelial differentiation G-protein coupled receptor 5 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 38883.16 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Membranes isolated from S1P2-transfected CHO cells were used in ligand binding assay. |
|---|
| Residue: | 353 |
|---|
| Sequence: | MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR
NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV
FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS
TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG
VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL
RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
|
|
|
|---|
| BDBM62400 |
|---|
| n/a |
|---|
| Name | BDBM62400 |
|---|
| Synonyms: | 5-(2,5-dichlorophenyl)-N-(2,6-dimethoxyphenyl)-2-furamide | 5-(2,5-dichlorophenyl)-N-(2,6-dimethoxyphenyl)-2-furancarboxamide | 5-(2,5-dichlorophenyl)-N-(2,6-dimethoxyphenyl)furan-2-carboxamide | 5-[2,5-bis(chloranyl)phenyl]-N-(2,6-dimethoxyphenyl)furan-2-carboxamide | SR-02000000244 | SR-02000000244-1 | cid_44607576 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H15Cl2NO4 |
|---|
| Mol. Mass. | 392.233 |
|---|
| SMILES | COc1cccc(OC)c1NC(=O)c1ccc(o1)-c1cc(Cl)ccc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
